Class b: All beta proteins [48724] (149 folds) |
Fold b.38: Sm-like fold [50181] (2 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (3 families) |
Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (7 proteins) forms homo and heteroheptameric ring structures |
Protein Archaeal homoheptameric Sm protein [63758] (5 species) |
Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [63759] (5 PDB entries) MTH649, smap1 |
Domain d1i81g_: 1i81 G: [61936] |
PDB Entry: 1i81 (more details), 2 Å
SCOP Domain Sequences for d1i81g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i81g_ b.38.1.1 (G:) Archaeal homoheptameric Sm protein {Archaeon Methanobacterium thermoautotrophicum} vnvqrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledgevtrrlgt vlirgdnivyisp
Timeline for d1i81g_: