Lineage for d1i81e_ (1i81 E:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798178Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 798179Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (6 families) (S)
  5. 798180Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (8 proteins)
    forms homo and heteroheptameric ring structures
  6. 798181Protein Archaeal homoheptameric Sm protein [63758] (6 species)
  7. 798227Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [63759] (5 PDB entries)
    MTH649, smap1
  8. 798246Domain d1i81e_: 1i81 E: [61934]

Details for d1i81e_

PDB Entry: 1i81 (more details), 2 Å

PDB Description: crystal structure of a heptameric lsm protein from methanobacterium thermoautotrophicum
PDB Compounds: (E:) putative snrnp sm-like protein

SCOP Domain Sequences for d1i81e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i81e_ b.38.1.1 (E:) Archaeal homoheptameric Sm protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}
vnvqrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledgevtrrlgt
vlirgdnivyisp

SCOP Domain Coordinates for d1i81e_:

Click to download the PDB-style file with coordinates for d1i81e_.
(The format of our PDB-style files is described here.)

Timeline for d1i81e_: