Lineage for d1i80b_ (1i80 B:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 317273Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 317289Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 317290Family c.56.2.1: Purine and uridine phosphorylases [53168] (4 proteins)
  6. 317338Protein Purine nucleoside phosphorylase, PNP [53169] (6 species)
  7. 317379Species Mycobacterium tuberculosis [TaxId:1773] [64098] (2 PDB entries)
  8. 317384Domain d1i80b_: 1i80 B: [61928]

Details for d1i80b_

PDB Entry: 1i80 (more details), 2 Å

PDB Description: crystal structure of m. tuberculosis pnp in complex with iminoribitol, 9-deazahypoxanthine and phosphate ion

SCOP Domain Sequences for d1i80b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i80b_ c.56.2.1 (B:) Purine nucleoside phosphorylase, PNP {Mycobacterium tuberculosis}
pdpdelarraaqviadrtgigehdvavvlgsgwlpavaalgspttvlpqaelpgfvppta
aghagellsvpigahrvlvlagrihayeghdlryvvhpvraaraagaqimvltnaagglr
adlqvgqpvlisdhlnltarsplvggefvdltdaysprlrelarqsdpqlaegvyaglpg
phyetpaeirmlqtlgadlvgmstvhetiaaraagaevlgvslvtnlaagitgeplshae
vlaagaasatrmgalladviarf

SCOP Domain Coordinates for d1i80b_:

Click to download the PDB-style file with coordinates for d1i80b_.
(The format of our PDB-style files is described here.)

Timeline for d1i80b_: