| Class b: All beta proteins [48724] (119 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
| Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species) |
| Species Fab GNC92H2, (mouse/human chimera), kappa L chain [63657] (1 PDB entry) |
| Domain d1i7zd2: 1i7z D:114-228 [61926] Other proteins in same PDB: d1i7za1, d1i7zb1, d1i7zc1, d1i7zd1 complexed with coc |
PDB Entry: 1i7z (more details), 2.3 Å
SCOP Domain Sequences for d1i7zd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i7zd2 b.1.1.2 (D:114-228) Immunoglobulin (constant domains of L and H chains) {Fab GNC92H2, (mouse/human chimera), kappa L chain}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
Timeline for d1i7zd2: