Lineage for d1i7zc1 (1i7z C:1-107)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 52357Species Fab GNC92H2, (mouse/human chimera), kappa L chain [63646] (1 PDB entry)
  8. 52360Domain d1i7zc1: 1i7z C:1-107 [61923]
    Other proteins in same PDB: d1i7za2, d1i7zb2, d1i7zc2, d1i7zd2

Details for d1i7zc1

PDB Entry: 1i7z (more details), 2.3 Å

PDB Description: antibody gnc92h2 bound to ligand

SCOP Domain Sequences for d1i7zc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i7zc1 b.1.1.1 (C:1-107) Immunoglobulin (variable domains of L and H chains) {Fab GNC92H2, (mouse/human chimera), kappa L chain}
dlvltqspaslavslgqratiscrasksvstsgynymhwyqqkpgqppklliylasnlas
gvparfsgsgsgtdftlnihpveeedaatyyclysrefppwtfgggtkleik

SCOP Domain Coordinates for d1i7zc1:

Click to download the PDB-style file with coordinates for d1i7zc1.
(The format of our PDB-style files is described here.)

Timeline for d1i7zc1: