Lineage for d1i7zb2 (1i7z B:114-228)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 549023Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 549027Species Human (Homo sapiens) [TaxId:9606] [88575] (105 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 549087Domain d1i7zb2: 1i7z B:114-228 [61922]
    Other proteins in same PDB: d1i7za1, d1i7za2, d1i7zb1, d1i7zc1, d1i7zc2, d1i7zd1

Details for d1i7zb2

PDB Entry: 1i7z (more details), 2.3 Å

PDB Description: antibody gnc92h2 bound to ligand

SCOP Domain Sequences for d1i7zb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i7zb2 b.1.1.2 (B:114-228) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

SCOP Domain Coordinates for d1i7zb2:

Click to download the PDB-style file with coordinates for d1i7zb2.
(The format of our PDB-style files is described here.)

Timeline for d1i7zb2: