SCOP 1.57: Domain d1i7zb2: 1i7z B:114-228

Lineage for d1i7zb2 (1i7z B:114-228)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)

7. Species Fab GNC92H2, (mouse/human chimera), kappa L chain [63657] (1 PDB entry)

8. Domain d1i7zb2: 1i7z B:114-228 [61922]
   Other proteins in same PDB: d1i7za1, d1i7zb1, d1i7zc1, d1i7zd1

Details for d1i7zb2

PDB Entry: 1i7z, 2.3 Å

PDB Description: antibody gnc92h2 bound to ligand

SCOP Domain Sequences for d1i7zb2:

Sequence; same for both SEQRES and ATOM records:

>d1i7zb2 b.1.1.2 (B:114-228) Immunoglobulin (constant domains of L and H chains) {Fab GNC92H2, (mouse/human chimera), kappa L chain}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

Timeline for d1i7zb2:

• d1i7zb2 is new in SCOP 1.57
  
• d1i7zb2 appears in SCOP 1.59
  
• d1i7zb2 appears in the current release, SCOPe 2.08