Lineage for d1i7xb_ (1i7x B:)

  1. Root: SCOPe 2.08
  2. 3045664Class j: Peptides [58231] (151 folds)
  3. 3046991Fold j.71: beta-Catenine bound non-globular protein regions [58753] (1 superfamily)
  4. 3046992Superfamily j.71.1: beta-Catenine bound non-globular protein regions [58754] (1 family) (S)
  5. 3046993Family j.71.1.1: beta-Catenine bound non-globular protein regions [58755] (3 proteins)
  6. 3047000Protein Phosphorylated E-cadherin [64636] (1 species)
  7. 3047001Species Mouse (Mus musculus) [TaxId:10090] [64637] (2 PDB entries)
  8. 3047004Domain d1i7xb_: 1i7x B: [61914]
    Other proteins in same PDB: d1i7xa_, d1i7xc_

Details for d1i7xb_

PDB Entry: 1i7x (more details), 3 Å

PDB Description: beta-catenin/e-cadherin complex
PDB Compounds: (B:) epithelial-cadherin

SCOPe Domain Sequences for d1i7xb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i7xb_ j.71.1.1 (B:) Phosphorylated E-cadherin {Mouse (Mus musculus) [TaxId: 10090]}
vtrndvaptlmsvpqyrprpanpdeignfidenlkaadsdptappydsllvfdyegs

SCOPe Domain Coordinates for d1i7xb_:

Click to download the PDB-style file with coordinates for d1i7xb_.
(The format of our PDB-style files is described here.)

Timeline for d1i7xb_: