Lineage for d1i7wd_ (1i7w D:)

  1. Root: SCOPe 2.01
  2. 1072259Class j: Peptides [58231] (120 folds)
  3. 1073579Fold j.71: beta-Catenine bound non-globular protein regions [58753] (1 superfamily)
  4. 1073580Superfamily j.71.1: beta-Catenine bound non-globular protein regions [58754] (1 family) (S)
  5. 1073581Family j.71.1.1: beta-Catenine bound non-globular protein regions [58755] (3 proteins)
  6. 1073588Protein Phosphorylated E-cadherin [64636] (1 species)
  7. 1073589Species Mouse (Mus musculus) [TaxId:10090] [64637] (2 PDB entries)
  8. 1073591Domain d1i7wd_: 1i7w D: [61912]
    Other proteins in same PDB: d1i7wa_, d1i7wc_
    complexed with cl, zn

Details for d1i7wd_

PDB Entry: 1i7w (more details), 2 Å

PDB Description: beta-catenin/phosphorylated e-cadherin complex
PDB Compounds: (D:) epithelial-cadherin

SCOPe Domain Sequences for d1i7wd_:

Sequence, based on SEQRES records: (download)

>d1i7wd_ j.71.1.1 (D:) Phosphorylated E-cadherin {Mouse (Mus musculus) [TaxId: 10090]}
dvaptlmsvpqyrprpanpdeignfidenlkaadsdptappydsllvfdyegsgseaasl
sslnssesdqdqdydylnewgnrfkkladmy

Sequence, based on observed residues (ATOM records): (download)

>d1i7wd_ j.71.1.1 (D:) Phosphorylated E-cadherin {Mouse (Mus musculus) [TaxId: 10090]}
dvapidenlkaadsdptappydsllvfdyegsgseaaslsslydylnewgnrfkkladmy

SCOPe Domain Coordinates for d1i7wd_:

Click to download the PDB-style file with coordinates for d1i7wd_.
(The format of our PDB-style files is described here.)

Timeline for d1i7wd_: