Lineage for d1i7wc_ (1i7w C:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 50498Fold a.118: alpha-alpha superhelix [48370] (11 superfamilies)
  4. 50499Superfamily a.118.1: ARM repeat [48371] (9 families) (S)
  5. 50500Family a.118.1.1: Armadillo repeat [48372] (5 proteins)
    this is a repeat family; one repeat unit is 1ee4 A:288-330 found in domain
  6. 50501Protein beta-Catenin [48373] (2 species)
  7. 50505Species Mouse (Mus musculus) [TaxId:10090] [48374] (4 PDB entries)
  8. 50507Domain d1i7wc_: 1i7w C: [61911]
    Other proteins in same PDB: d1i7wb_, d1i7wd_

Details for d1i7wc_

PDB Entry: 1i7w (more details), 2 Å

PDB Description: beta-catenin/phosphorylated e-cadherin complex

SCOP Domain Sequences for d1i7wc_:

Sequence, based on SEQRES records: (download)

>d1i7wc_ a.118.1.1 (C:) beta-Catenin {Mouse (Mus musculus)}
qddaelatraipeltkllndedqvvvnkaavmvhqlskkeasrhaimrspqmvsaivrtm
qntndvetarctagtlhnlshhregllaifksggipalvkmlgspvdsvlfyaittlhnl
llhqegakmavrlagglqkmvallnktnvkflaittdclqilaygnqeskliilasggpq
alvnimrtytyekllwttsrvlkvlsvcssnkpaiveaggmqalglhltdpsqrlvqncl
wtlrnlsdaatkqegmegllgtlvqllgsddinvvtcaagilsnltcnnyknkmmvcqvg
giealvrtvlragdreditepaicalrhltsrhqeaemaqnavrlhyglpvvvkllhpps
hwplikatvglirnlalcpanhaplreqgaiprlvqllvrahqdtqrrtsmggtqqqfve
gvrmeeivegctgalhilardvhnrivirglntiplfvqllyspieniqrvaagvlcela
qdkeaaeaieaegatapltellhsrnegvatyaaavlfrms

Sequence, based on observed residues (ATOM records): (download)

>d1i7wc_ a.118.1.1 (C:) beta-Catenin {Mouse (Mus musculus)}
qddaelatraipeltkllndedqvvvnkaavmvhqlskkeasrhaimrspqmvsaivrtm
qntndvetarctagtlhnlshhregllaifksggipalvkmlgspvdsvlfyaittlhnl
llhqegakmavrlagglqkmvallnktnvkflaittdclqilaygnqeskliilasggpq
alvnimrtytyekllwttsrvlkvlsvcssnkpaiveaggmqalglhltdpsqrlvqncl
wtlrnlsdaatkqegmegllgtlvqllgsddinvvtcaagilsnltcnnyknkmmvcqvg
giealvrtvlragdreditepaicalrhltsrhqeaemaqnavrlhyglpvvvkllhpps
hwplikatvglirnlalcpanhaplreqgaiprlvqllvrahqdtqrrtvrmeeivegct
galhilardvhnrivirglntiplfvqllyspieniqrvaagvlcelaqdkeaaeaieae
gatapltellhsrnegvatyaaavlfrms

SCOP Domain Coordinates for d1i7wc_:

Click to download the PDB-style file with coordinates for d1i7wc_.
(The format of our PDB-style files is described here.)

Timeline for d1i7wc_: