Lineage for d1i7wb_ (1i7w B:)

  1. Root: SCOPe 2.07
  2. 2650239Class j: Peptides [58231] (148 folds)
  3. 2651566Fold j.71: beta-Catenine bound non-globular protein regions [58753] (1 superfamily)
  4. 2651567Superfamily j.71.1: beta-Catenine bound non-globular protein regions [58754] (1 family) (S)
  5. 2651568Family j.71.1.1: beta-Catenine bound non-globular protein regions [58755] (3 proteins)
  6. 2651575Protein Phosphorylated E-cadherin [64636] (1 species)
  7. 2651576Species Mouse (Mus musculus) [TaxId:10090] [64637] (2 PDB entries)
  8. 2651577Domain d1i7wb_: 1i7w B: [61910]
    Other proteins in same PDB: d1i7wa_, d1i7wc_
    complexed with cl, zn

Details for d1i7wb_

PDB Entry: 1i7w (more details), 2 Å

PDB Description: beta-catenin/phosphorylated e-cadherin complex
PDB Compounds: (B:) epithelial-cadherin

SCOPe Domain Sequences for d1i7wb_:

Sequence, based on SEQRES records: (download)

>d1i7wb_ j.71.1.1 (B:) Phosphorylated E-cadherin {Mouse (Mus musculus) [TaxId: 10090]}
lkaadsdptappydsllvfdyegsgseaaslsslnssesdqdqdydylnewgnrfkklad
my

Sequence, based on observed residues (ATOM records): (download)

>d1i7wb_ j.71.1.1 (B:) Phosphorylated E-cadherin {Mouse (Mus musculus) [TaxId: 10090]}
lkaadsdptappydsllvfdyegsgseaaslssldylnewgnrfkkladmy

SCOPe Domain Coordinates for d1i7wb_:

Click to download the PDB-style file with coordinates for d1i7wb_.
(The format of our PDB-style files is described here.)

Timeline for d1i7wb_: