| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) ![]() |
| Family d.20.1.1: UBC-related [54496] (7 proteins) |
| Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species) |
| Species Human (Homo sapiens), ubch10 [TaxId:9606] [64243] (1 PDB entry) |
| Domain d1i7kb_: 1i7k B: [61890] |
PDB Entry: 1i7k (more details), 1.95 Å
SCOPe Domain Sequences for d1i7kb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i7kb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch10 [TaxId: 9606]}
pvgkrlqqelmtlmmsgdkgisafpesdnlfkwvgtihgaagtvyedlryklslefpsgy
pynaptvkfltpcyhpnvdtqgnisldilkekwsalydvrtillsiqsllgepnidspln
thaaelwknptafkkylqetyskqvt
Timeline for d1i7kb_: