Lineage for d1i7kb_ (1i7k B:)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.20: Ubiquitin conjugating enzyme [54494] (1 superfamily) Superfamily d.20.1: Ubiquitin conjugating enzyme [54495] (1 family) 
Family d.20.1.1: Ubiquitin conjugating enzyme [54496] (1 protein) Protein Ubiquitin conjugating enzyme [54497] (12 species) 
Species Human (Homo sapiens), ubch10 [TaxId:9606] [64243] (1 PDB entry) 
Domain d1i7kb_: 1i7k B: [61890]
Details for d1i7kb_
PDB Entry: 1i7k (more details), 1.95 Å
PDB Description: crystal structure of human mitotic-specific ubiquitin-conjugating enzyme, ubch10
SCOP Domain Sequences for d1i7kb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i7kb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme {Human (Homo sapiens), ubch10}
pvgkrlqqelmtlmmsgdkgisafpesdnlfkwvgtihgaagtvyedlryklslefpsgy
pynaptvkfltpcyhpnvdtqgnisldilkekwsalydvrtillsiqsllgepnidspln
thaaelwknptafkkylqetyskqvt
SCOP Domain Coordinates for d1i7kb_:
Click to download the PDB-style file with coordinates for d1i7kb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1i7kb_:
- d1i7kb_ is new in SCOP 1.57
- d1i7kb_ appears in SCOP 1.59
- d1i7kb_ appears in the current release, SCOPe 2.08
View in 3D
