Lineage for d1i7ka_ (1i7k A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1898312Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1898313Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1898314Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 1898322Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)
  7. 1898449Species Human (Homo sapiens), ubch10 [TaxId:9606] [64243] (1 PDB entry)
  8. 1898450Domain d1i7ka_: 1i7k A: [61889]

Details for d1i7ka_

PDB Entry: 1i7k (more details), 1.95 Å

PDB Description: crystal structure of human mitotic-specific ubiquitin-conjugating enzyme, ubch10
PDB Compounds: (A:) ubiquitin-conjugating enzyme e2 h10

SCOPe Domain Sequences for d1i7ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i7ka_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch10 [TaxId: 9606]}
pvgkrlqqelmtlmmsgdkgisafpesdnlfkwvgtihgaagtvyedlryklslefpsgy
pynaptvkfltpcyhpnvdtqgnisldilkekwsalydvrtillsiqsllgepnidspln
thaaelwknptafkkylqetyskqvt

SCOPe Domain Coordinates for d1i7ka_:

Click to download the PDB-style file with coordinates for d1i7ka_.
(The format of our PDB-style files is described here.)

Timeline for d1i7ka_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1i7kb_