Lineage for d1i7ka_ (1i7k A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 78902Fold d.20: Ubiquitin conjugating enzyme [54494] (1 superfamily)
  4. 78903Superfamily d.20.1: Ubiquitin conjugating enzyme [54495] (1 family) (S)
  5. 78904Family d.20.1.1: Ubiquitin conjugating enzyme [54496] (1 protein)
  6. 78905Protein Ubiquitin conjugating enzyme [54497] (12 species)
  7. 78933Species Human (Homo sapiens), ubch10 [TaxId:9606] [64243] (1 PDB entry)
  8. 78934Domain d1i7ka_: 1i7k A: [61889]

Details for d1i7ka_

PDB Entry: 1i7k (more details), 1.95 Å

PDB Description: crystal structure of human mitotic-specific ubiquitin-conjugating enzyme, ubch10

SCOP Domain Sequences for d1i7ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i7ka_ d.20.1.1 (A:) Ubiquitin conjugating enzyme {Human (Homo sapiens), ubch10}
pvgkrlqqelmtlmmsgdkgisafpesdnlfkwvgtihgaagtvyedlryklslefpsgy
pynaptvkfltpcyhpnvdtqgnisldilkekwsalydvrtillsiqsllgepnidspln
thaaelwknptafkkylqetyskqvt

SCOP Domain Coordinates for d1i7ka_:

Click to download the PDB-style file with coordinates for d1i7ka_.
(The format of our PDB-style files is described here.)

Timeline for d1i7ka_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1i7kb_