Lineage for d1i7ea_ (1i7e A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2509453Fold d.23: Tubby C-terminal domain-like [54517] (1 superfamily)
    beta-sheet folds into a barrel (n=12, S=12) around the central helix
  4. 2509454Superfamily d.23.1: Tubby C-terminal domain-like [54518] (2 families) (S)
  5. 2509455Family d.23.1.1: Transcriptional factor tubby, C-terminal domain [54519] (2 protein domains)
    automatically mapped to Pfam PF01167
  6. 2509456Protein Transcriptional factor tubby, C-terminal domain [54520] (1 species)
  7. 2509457Species Mouse (Mus musculus) [TaxId:10090] [54521] (2 PDB entries)
  8. 2509459Domain d1i7ea_: 1i7e A: [61887]
    complexed to phosphatidylinositol 4,5-bis-phosphate
    complexed with ibs

Details for d1i7ea_

PDB Entry: 1i7e (more details), 1.95 Å

PDB Description: c-terminal domain of mouse brain tubby protein bound to phosphatidylinositol 4,5-bis-phosphate
PDB Compounds: (A:) tubby protein

SCOPe Domain Sequences for d1i7ea_:

Sequence, based on SEQRES records: (download)

>d1i7ea_ d.23.1.1 (A:) Transcriptional factor tubby, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
dievqdleefalrpapqgitikcritrdkkgmdrgmfptyflhldredgkkvfllagrkr
kksktsnylisvdptdlsrggdsyigklrsnlmgtkftvydngvnpqkassstlesgtlr
qelaavcyetnvlgfkgprkmsvivpgmnmvhervcirprnehetllarwqnkntesiie
lqnktpvwnddtesyvlnfhgrvtqasvknfqiihgndpdyivmqfgrvaedvftmdyny
plcalqafaialssfdskl

Sequence, based on observed residues (ATOM records): (download)

>d1i7ea_ d.23.1.1 (A:) Transcriptional factor tubby, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
dievqdleefalrpapqgitikcritrdkgmfptyflhldredgkkvfllagrkrnylis
vdptgdsyigklrsnlmgtkftvydngvnpqkassstlesgtlrqelaavcyekgprkms
vivpgmnmvhervcirprnehetllarwqnkntesiielqnktpvwnddtesyvlnfhgr
vtqasvknfqiihgndpdyivmqfgrvaedvftmdynyplcalqafaialssfdskl

SCOPe Domain Coordinates for d1i7ea_:

Click to download the PDB-style file with coordinates for d1i7ea_.
(The format of our PDB-style files is described here.)

Timeline for d1i7ea_: