Lineage for d1i7da_ (1i7d A:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2623922Fold e.10: Prokaryotic type I DNA topoisomerase [56711] (1 superfamily)
    4 domains: (1) Toprim alpha/beta; (2&4) "winged helix"-like; (3) barrel: n=6, S=8
  4. 2623923Superfamily e.10.1: Prokaryotic type I DNA topoisomerase [56712] (2 families) (S)
    duplication: the protein chain passing through the domains 2-4 makes two structural repeats
    The active site is formed by the toprim and "winged helix" domains (domains 1 and 4); these two domains are also found in the type II topoisomerase (DNA gyrase A) and in the alpha subunit of topoisomerase IV
  5. 2623924Family e.10.1.1: Prokaryotic type I DNA topoisomerase [56713] (4 proteins)
    domain 4 contains the catalytic tyrosine residue
  6. 2623941Protein DNA topoisomerase III [56716] (1 species)
  7. 2623942Species Escherichia coli [TaxId:562] [56717] (2 PDB entries)
  8. 2623943Domain d1i7da_: 1i7d A: [61886]
    protein/DNA complex; complexed with cl, so4

Details for d1i7da_

PDB Entry: 1i7d (more details), 2.05 Å

PDB Description: noncovalent complex of e.coli dna topoisomerase iii with an 8-base single-stranded dna oligonucleotide
PDB Compounds: (A:) DNA topoisomerase III

SCOPe Domain Sequences for d1i7da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i7da_ e.10.1.1 (A:) DNA topoisomerase III {Escherichia coli [TaxId: 562]}
mrlfiaekpslaraiadvlpkphrkgdgfiecgngqvvtwcighlleqaqpdaydsryar
wnladlpivpekwqlqprpsvtkqlnvikrflheaseivhagdpdregqllvdevldylq
lapekrqqvqrclindlnpqaveraidrlrsnsefvplcvsalararadwlyginmtray
tilgrnagyqgvlsvgrvqtpvlglvvrrdeeienfvakdffevkahivtpaderftaiw
qpseacepyqdeegrllhrplaehvvnrisgqpaivtsyndkresesaplpfslsalqie
aakrfglsaqnvldicqklyethklitfprsdcrylpeehfagrhavmnaisvhapdllp
qpvvdpdirnrcwddkkvdahhaiiptarssainlteneakvynliarqylmqfcpdavf
rkcvieldiakgkfvakarflaeagwrtllgskerdeendgtplpvvakgdellcekgev
verqtqpprhftdatllsamtgiarfvqdkdlkkilratdglgteatragiiellfkrgf
ltkkgryihstdagkalfhslpematrpdmtahwesvltqisekqcryqdfmqplvgtly
qlidqakrtpvrqfrgivap

SCOPe Domain Coordinates for d1i7da_:

Click to download the PDB-style file with coordinates for d1i7da_.
(The format of our PDB-style files is described here.)

Timeline for d1i7da_: