SCOPe 2.02: Domain d1i7ac_: 1i7a C:

Lineage for d1i7ac_ (1i7a C:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.4: Enabled/VASP homology 1 domain (EVH1 domain) [50767] (6 proteins)

6. Protein Homer [50774] (2 species)

7. Species Mouse (Mus musculus), 2b/vesl 2 [TaxId:10090] [63800] (1 PDB entry)

8. Domain d1i7ac_: 1i7a C: [61882]
   complexed with flc, phe

Details for d1i7ac_

PDB Entry: 1i7a, 2.24 Å

PDB Description: evh1 domain from murine homer 2b/vesl 2

PDB Compounds: (C:) homer 2b

SCOPe Domain Sequences for d1i7ac_:

Sequence, based on SEQRES records:

>d1i7ac_ b.55.1.4 (C:) Homer {Mouse (Mus musculus), 2b/vesl 2 [TaxId: 10090]}
eqpifttrahvfqidpstkknwvpaskqavtvsyfydvtrnsyriisvdgakviinstit
pnmtftktsqkfgqwadsrantvfglgfsselqltkfaekfqevreaar

Sequence, based on observed residues (ATOM records):

>d1i7ac_ b.55.1.4 (C:) Homer {Mouse (Mus musculus), 2b/vesl 2 [TaxId: 10090]}
eqpifttrahvfqinwvpaskqavtvsyfydvtrnsyriisvdgakviinstitpnmtft
ktsqkfgqwadsrantvfglgfsselqltkfaekfqevreaar

Timeline for d1i7ac_:

• d1i7ac_ first appeared in SCOP 1.57
  
• d1i7ac_ appears in SCOPe 2.01
  
• d1i7ac_ appears in SCOPe 2.03
  
• d1i7ac_ appears in the current release, SCOPe 2.08