Lineage for d1i7ac_ (1i7a C:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1132154Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 1132155Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 1132514Family b.55.1.4: Enabled/VASP homology 1 domain (EVH1 domain) [50767] (6 proteins)
  6. 1132531Protein Homer [50774] (2 species)
  7. 1132532Species Mouse (Mus musculus), 2b/vesl 2 [TaxId:10090] [63800] (1 PDB entry)
  8. 1132535Domain d1i7ac_: 1i7a C: [61882]
    complexed with flc, phe

Details for d1i7ac_

PDB Entry: 1i7a (more details), 2.24 Å

PDB Description: evh1 domain from murine homer 2b/vesl 2
PDB Compounds: (C:) homer 2b

SCOPe Domain Sequences for d1i7ac_:

Sequence, based on SEQRES records: (download)

>d1i7ac_ b.55.1.4 (C:) Homer {Mouse (Mus musculus), 2b/vesl 2 [TaxId: 10090]}
eqpifttrahvfqidpstkknwvpaskqavtvsyfydvtrnsyriisvdgakviinstit
pnmtftktsqkfgqwadsrantvfglgfsselqltkfaekfqevreaar

Sequence, based on observed residues (ATOM records): (download)

>d1i7ac_ b.55.1.4 (C:) Homer {Mouse (Mus musculus), 2b/vesl 2 [TaxId: 10090]}
eqpifttrahvfqinwvpaskqavtvsyfydvtrnsyriisvdgakviinstitpnmtft
ktsqkfgqwadsrantvfglgfsselqltkfaekfqevreaar

SCOPe Domain Coordinates for d1i7ac_:

Click to download the PDB-style file with coordinates for d1i7ac_.
(The format of our PDB-style files is described here.)

Timeline for d1i7ac_: