Lineage for d1i75a1 (1i75 A:497-582)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 788950Superfamily b.1.18: E set domains [81296] (23 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 789056Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 789101Protein Cyclomaltodextrin glycanotransferase, domain D [49215] (5 species)
    follows the starch-binding domain C; the catalytic domain A has (beta/alpha)8-barrel fold; family 13 glycosyl hydrolases
  7. 789143Species Bacillus sp., strain 1011 [TaxId:1409] [49219] (8 PDB entries)
    Uniprot P05618
  8. 789146Domain d1i75a1: 1i75 A:497-582 [61869]
    Other proteins in same PDB: d1i75a2, d1i75a3, d1i75a4, d1i75b2, d1i75b3, d1i75b4

Details for d1i75a1

PDB Entry: 1i75 (more details), 2 Å

PDB Description: crystal structure of cyclodextrin glucanotransferase from alkalophilic bacillus sp.#1011 complexed with 1-deoxynojirimycin
PDB Compounds: (A:) cyclodextrin glucanotransferase

SCOP Domain Sequences for d1i75a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i75a1 b.1.18.2 (A:497-582) Cyclomaltodextrin glycanotransferase, domain D {Bacillus sp., strain 1011 [TaxId: 1409]}
ttpiignvgpmmakpgvtitidgrgfgsgkgtvyfgttavtgadivawedtqiqvkipav
pggiydirvanaagaasniydnfevl

SCOP Domain Coordinates for d1i75a1:

Click to download the PDB-style file with coordinates for d1i75a1.
(The format of our PDB-style files is described here.)

Timeline for d1i75a1: