Lineage for d1i73a_ (1i73 A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 82192Fold d.92: Zincin-like [55485] (2 superfamilies)
  4. 82193Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (13 families) (S)
  5. 82321Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (8 proteins)
  6. 82364Protein Neutrophil collagenase (MMP-8) [55532] (1 species)
  7. 82365Species Human (Homo sapiens) [TaxId:9606] [55533] (13 PDB entries)
  8. 82367Domain d1i73a_: 1i73 A: [61866]

Details for d1i73a_

PDB Entry: 1i73 (more details), 1.4 Å

PDB Description: complex of pro-leu-l-trp phosphonate with the catalitic domain of matrix metallo proteinase-8 (met80 form)

SCOP Domain Sequences for d1i73a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i73a_ d.92.1.11 (A:) Neutrophil collagenase (MMP-8) {Human (Homo sapiens)}
mltpgnpkwertnltyrirnytpqlseaeveraikdafelwsvaspliftrisqgeadin
iafyqrdhgdnspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahef
ghslglahssdpgalmypnyafretsnyslpqddidgiqaiyg

SCOP Domain Coordinates for d1i73a_:

Click to download the PDB-style file with coordinates for d1i73a_.
(The format of our PDB-style files is described here.)

Timeline for d1i73a_: