![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) ![]() |
![]() | Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins) |
![]() | Protein Neutrophil collagenase (MMP-8) [55532] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [55533] (24 PDB entries) |
![]() | Domain d1i73a_: 1i73 A: [61866] complexed with ca, zn |
PDB Entry: 1i73 (more details), 1.4 Å
SCOPe Domain Sequences for d1i73a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i73a_ d.92.1.11 (A:) Neutrophil collagenase (MMP-8) {Human (Homo sapiens) [TaxId: 9606]} mltpgnpkwertnltyrirnytpqlseaeveraikdafelwsvaspliftrisqgeadin iafyqrdhgdnspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahef ghslglahssdpgalmypnyafretsnyslpqddidgiqaiyg
Timeline for d1i73a_: