Lineage for d1i71a_ (1i71 A:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2260117Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 2260118Superfamily g.14.1: Kringle-like [57440] (3 families) (S)
  5. 2260119Family g.14.1.1: Kringle modules [57441] (7 proteins)
  6. 2260120Protein Apolipoprotein A [57455] (3 species)
  7. 2260127Species Human (Homo sapiens), IV-7 variant [TaxId:9606] [64559] (1 PDB entry)
  8. 2260128Domain d1i71a_: 1i71 A: [61864]
    complexed with so4

Details for d1i71a_

PDB Entry: 1i71 (more details), 1.45 Å

PDB Description: high resolution crystal structure of apolipoprotein(a) kringle iv type 7: insights into ligand binding
PDB Compounds: (A:) apolipoprotein(a)

SCOPe Domain Sequences for d1i71a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i71a_ g.14.1.1 (A:) Apolipoprotein A {Human (Homo sapiens), IV-7 variant [TaxId: 9606]}
dcyhgdgqsyrgsfsttvtgrtcqswssmtphwhqrtteyypnggltrnycrnpdaeirp
wcytmdpsvrweycnltqcpvme

SCOPe Domain Coordinates for d1i71a_:

Click to download the PDB-style file with coordinates for d1i71a_.
(The format of our PDB-style files is described here.)

Timeline for d1i71a_: