Lineage for d1i71a_ (1i71 A:)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 89571Fold g.14: Kringle-like [57439] (1 superfamily)
  4. 89572Superfamily g.14.1: Kringle-like [57440] (2 families) (S)
  5. 89573Family g.14.1.1: Kringle modules [57441] (7 proteins)
  6. 89574Protein Apolipoprotein A kringle domain [57455] (2 species)
  7. 89579Species Human (Homo sapiens), IV-7 variant [TaxId:9606] [64559] (1 PDB entry)
  8. 89580Domain d1i71a_: 1i71 A: [61864]

Details for d1i71a_

PDB Entry: 1i71 (more details), 1.45 Å

PDB Description: high resolution crystal structure of apolipoprotein(a) kringle iv type 7: insights into ligand binding

SCOP Domain Sequences for d1i71a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i71a_ g.14.1.1 (A:) Apolipoprotein A kringle domain {Human (Homo sapiens), IV-7 variant}
dcyhgdgqsyrgsfsttvtgrtcqswssmtphwhqrtteyypnggltrnycrnpdaeirp
wcytmdpsvrweycnltqcpvme

SCOP Domain Coordinates for d1i71a_:

Click to download the PDB-style file with coordinates for d1i71a_.
(The format of our PDB-style files is described here.)

Timeline for d1i71a_: