Lineage for d1i6za1 (1i6z A:90-219)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2309866Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2310127Superfamily a.7.7: BAG domain [63491] (1 family) (S)
  5. 2310128Family a.7.7.1: BAG domain [63492] (4 proteins)
    Pfam PF02179
    this is a repeat family; one repeat unit is 1hx1 B:151-261 found in domain
  6. 2310129Protein BAG-family molecular chaperon regulator-1, BAG1 [63493] (3 species)
  7. 2310139Species Mouse (Mus musculus) [TaxId:10090] [63495] (1 PDB entry)
  8. 2310140Domain d1i6za1: 1i6z A:90-219 [61861]
    Other proteins in same PDB: d1i6za2

Details for d1i6za1

PDB Entry: 1i6z (more details)

PDB Description: bag domain of bag1 cochaperone
PDB Compounds: (A:) bag-family molecular chaperone regulator-1

SCOPe Domain Sequences for d1i6za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i6za1 a.7.7.1 (A:90-219) BAG-family molecular chaperon regulator-1, BAG1 {Mouse (Mus musculus) [TaxId: 10090]}
mligeksnpeeevelkklkdlevsaekianhlqelnkelsgiqqgflakelqaealckld
rkvkatieqfmkileeidtmvlpeqfkdsrlkrknlvkkvqvflaecdtveqyicqeter
lqstnlalae

SCOPe Domain Coordinates for d1i6za1:

Click to download the PDB-style file with coordinates for d1i6za1.
(The format of our PDB-style files is described here.)

Timeline for d1i6za1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i6za2