SCOPe 2.05: Domain d1i6wb_: 1i6w B:

Lineage for d1i6wb_ (1i6w B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.18: Bacterial lipase [53570] (4 proteins)
   lack the first two strands of the common fold

6. Protein Lipase A [64145] (3 species)
   minimal alpha/beta hydrolase fold;

7. Species Bacillus subtilis [TaxId:1423] [64146] (18 PDB entries)
   Uniprot P37957 34-212

8. Domain d1i6wb_: 1i6w B: [61860]
   complexed with cd

Details for d1i6wb_

PDB Entry: 1i6w, 1.5 Å

PDB Description: the crystal structure of bacillus subtilis lipase: a minimal alpha/beta hydrolase enzyme

PDB Compounds: (B:) lipase a

SCOPe Domain Sequences for d1i6wb_:

Sequence; same for both SEQRES and ATOM records:

>d1i6wb_ c.69.1.18 (B:) Lipase A {Bacillus subtilis [TaxId: 1423]}
ehnpvvmvhgiggasfnfagiksylvsqgwsrdklyavdfwdktgtnynngpvlsrfvqk
vldetgakkvdivahsmggantlyyiknldggnkvanvvtlgganrlttgkalpgtdpnq
kilytsiyssadmivmnylsrldgarnvqihgvghigllyssqvnslikeglngggqntn

Timeline for d1i6wb_:

• d1i6wb_ first appeared in SCOP 1.57
  
• d1i6wb_ appears in SCOPe 2.04
  
• d1i6wb_ appears in SCOPe 2.06
  
• d1i6wb_ appears in the current release, SCOPe 2.08