SCOP 1.59: Domain d1i6ve_: 1i6v E:

Lineage for d1i6ve_ (1i6v E:)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.143: RNA polymerase omega subunit [63561] (1 superfamily)

4. Superfamily a.143.1: RNA polymerase omega subunit [63562] (1 family)

5. Family a.143.1.1: RNA polymerase omega subunit [63563] (1 protein)

6. Protein RNA polymerase omega subunit [63564] (1 species)

7. Species Thermus aquaticus [TaxId:271] [63565] (1 PDB entry)

8. Domain d1i6ve_: 1i6v E: [61858]
   Other proteins in same PDB: d1i6va1, d1i6va2, d1i6vb1, d1i6vb2, d1i6vc_, d1i6vd_

Details for d1i6ve_

PDB Entry: 1i6v, 3.3 Å

PDB Description: thermus aquaticus core rna polymerase-rifampicin complex

SCOP Domain Sequences for d1i6ve_:

Sequence; same for both SEQRES and ATOM records:

>d1i6ve_ a.143.1.1 (E:) RNA polymerase omega subunit {Thermus aquaticus}
maepgidklfgmvdskyrltvvvakraqqllrhrfkntvlepeerpkmrtleglyddpna
vtwamkelltgrlffgenlvpedrlqkemerlypteee

Timeline for d1i6ve_:

• d1i6ve_ first appeared in SCOP 1.57
  
• d1i6ve_ appears in SCOP 1.61
  
• d1i6ve_ appears in the current release, SCOPe 2.08