Lineage for d1i6vc_ (1i6v C:)

  1. Root: SCOP 1.57
  2. 86313Class e: Multi-domain proteins (alpha and beta) [56572] (32 folds)
  3. 87484Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
  4. 87485Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
  5. 87486Family e.29.1.1: RNA-polymerase beta [64485] (2 proteins)
  6. 87492Protein RNA-polymerase beta [64488] (1 species)
  7. 87493Species Thermus aquaticus [TaxId:271] [64489] (1 PDB entry)
  8. 87494Domain d1i6vc_: 1i6v C: [61856]
    Other proteins in same PDB: d1i6va1, d1i6va2, d1i6vb1, d1i6vb2, d1i6vd_, d1i6ve_

Details for d1i6vc_

PDB Entry: 1i6v (more details), 3.3 Å

PDB Description: thermus aquaticus core rna polymerase-rifampicin complex

SCOP Domain Sequences for d1i6vc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i6vc_ e.29.1.1 (C:) RNA-polymerase beta {Thermus aquaticus}
kikrfgrireviplpplteiqvesykkalqadvppekrenvgiqaafketfpieegdkgk
gglvldfleyrigdppfsqdecrekdltyqaplyarlqlihkdtglikedevflghlplm
tedgsfiingadrvivsqihrspgvyftpdparpgryiasiiplpkrgpwidleveasgv
vtmkvnkrkfplvlllrvlgydqetlvrelsaygdlvqglldeavlamrpeeamvrlftl
lrpgdppkkdkalaylfglladpkrydlgeagrykaeeklgvglsgrtlvrfedgefkde
vflptlrylfaltagvpghevddidhlgnrrirtvgelmadqfrvglarlargvrermvm
gspdtltpaklvnsrpleaalreffsrsqlsqfkdetnplsslrhkrrisalgpggltre
ragfdvrdvhrthygricpvetpeganiglitslaayarvdalgfirtpyrrvkngvvte
evvymtaseedrytiaqantplegdriatdrvvarrrgepvivapeevefmdvspkqvfs
lntnlipflehddanralmgsnmqtqavpliraqapvvmtgleervvrdslaalyaeedg
evvkvdgtriavryedgrlvhplrryarsnqgtafdqrprvrvgqrvkkgdlladgpase
egflalgqnvlvaimpfdgynfedaiviseellkrdfytsihieryeieardtklgperi
trdiphlseaalrdldeegivrigaevkpgdilvgrtsfkgeqepspeerllrsifgeka
rdvkdtslrvppgeggivvgrlrlrrgdpgvelkpgvrevvrvfvaqkrklqvgdklanr
hgnkgvvakilpvedmphlpdgtpvdvilnplgvpsrmnlgqilethlglagyflgqryi
spvfdgatepeikellaeafnlyfgkrqgegfgvdkrekevlaraeklglvspgkspeeq
lkelfdlgkvvlydgrtgepfegpivvgqmfimklyhmvedkmharstgpyslitqqplg
gkaqfggqrfgemevwaleaygaahtlqemltiksddiegrnaayqaiikgedvpepsvp
esfrvlvkelqalaldvqtldekdnpvdvfegl

SCOP Domain Coordinates for d1i6vc_:

Click to download the PDB-style file with coordinates for d1i6vc_.
(The format of our PDB-style files is described here.)

Timeline for d1i6vc_: