SCOP 1.69: Domain d1i6vb2: 1i6v B:50-172

Lineage for d1i6vb2 (1i6v B:50-172)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
   unusual fold; contains a left-handed beta-alpha-beta unit

4. Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family)

5. Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins)

6. Protein RNA polymerase alpha subunit [56555] (3 species)

7. Species Thermus aquaticus [TaxId:271] [64461] (1 PDB entry)

8. Domain d1i6vb2: 1i6v B:50-172 [61855]
   Other proteins in same PDB: d1i6va1, d1i6vb1, d1i6vc_, d1i6vd_, d1i6ve_

Details for d1i6vb2

PDB Entry: 1i6v, 3.3 Å

PDB Description: thermus aquaticus core rna polymerase-rifampicin complex

SCOP Domain Sequences for d1i6vb2:

Sequence; same for both SEQRES and ATOM records:

>d1i6vb2 d.181.1.1 (B:50-172) RNA polymerase alpha subunit {Thermus aquaticus}
gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrfldpkmasttlilraegpkev
ravdftpsadveimnpdlhiatleeggklymevrvdrgvgyvpaerhgikdrinaipvda
ifs

Timeline for d1i6vb2:

• d1i6vb2 first appeared in SCOP 1.57
  
• d1i6vb2 appears in SCOP 1.67
  
• d1i6vb2 appears in SCOP 1.71
  
• d1i6vb2 appears in the current release, SCOPe 2.08