Lineage for d1i6vb2 (1i6v B:50-172)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 199375Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
  4. 199376Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) (S)
  5. 199377Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins)
  6. 199378Protein RNA polymerase alpha subunit [56555] (3 species)
  7. 199384Species Thermus aquaticus [TaxId:271] [64461] (1 PDB entry)
  8. 199386Domain d1i6vb2: 1i6v B:50-172 [61855]
    Other proteins in same PDB: d1i6va1, d1i6vb1, d1i6vc_, d1i6vd_, d1i6ve_

Details for d1i6vb2

PDB Entry: 1i6v (more details), 3.3 Å

PDB Description: thermus aquaticus core rna polymerase-rifampicin complex

SCOP Domain Sequences for d1i6vb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i6vb2 d.181.1.1 (B:50-172) RNA polymerase alpha subunit {Thermus aquaticus}
gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrfldpkmasttlilraegpkev
ravdftpsadveimnpdlhiatleeggklymevrvdrgvgyvpaerhgikdrinaipvda
ifs

SCOP Domain Coordinates for d1i6vb2:

Click to download the PDB-style file with coordinates for d1i6vb2.
(The format of our PDB-style files is described here.)

Timeline for d1i6vb2: