![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.74: DCoH-like [55247] (4 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
![]() | Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families) ![]() form homo and heterodimers |
![]() | Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins) |
![]() | Protein RNA polymerase alpha [55259] (3 species) |
![]() | Species Thermus aquaticus [TaxId:271] [64314] (4 PDB entries) |
![]() | Domain d1i6vb1: 1i6v B:3-49,B:173-232 [61854] Other proteins in same PDB: d1i6va2, d1i6vb2, d1i6vc_, d1i6vd_, d1i6ve_ complexed with mg, rfp, zn |
PDB Entry: 1i6v (more details), 3.3 Å
SCOP Domain Sequences for d1i6vb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i6vb1 d.74.3.1 (B:3-49,B:173-232) RNA polymerase alpha {Thermus aquaticus [TaxId: 271]} esklkapvftattqgdhygefvleplergfgvtlgnplrrillssipXpvrrvafqvedt rlgqrtdldkltlriwtdgsvtplealnqavailkehlnyfanpeass
Timeline for d1i6vb1: