Lineage for d1i6va1 (1i6v A:6-49,A:173-229)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 865191Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 865274Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families) (S)
    form homo and heterodimers
  5. 865275Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins)
  6. 865276Protein RNA polymerase alpha [55259] (3 species)
  7. 865282Species Thermus aquaticus [TaxId:271] [64314] (4 PDB entries)
  8. 865285Domain d1i6va1: 1i6v A:6-49,A:173-229 [61852]
    Other proteins in same PDB: d1i6va2, d1i6vb2, d1i6vc_, d1i6vd_, d1i6ve_

Details for d1i6va1

PDB Entry: 1i6v (more details), 3.3 Å

PDB Description: thermus aquaticus core rna polymerase-rifampicin complex
PDB Compounds: (A:) DNA-directed RNA polymerase

SCOP Domain Sequences for d1i6va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i6va1 d.74.3.1 (A:6-49,A:173-229) RNA polymerase alpha {Thermus aquaticus [TaxId: 271]}
lkapvftattqgdhygefvleplergfgvtlgnplrrillssipXpvrrvafqvedtrlg
qrtdldkltlriwtdgsvtplealnqavailkehlnyfanpe

SCOP Domain Coordinates for d1i6va1:

Click to download the PDB-style file with coordinates for d1i6va1.
(The format of our PDB-style files is described here.)

Timeline for d1i6va1: