Lineage for d1i6ub_ (1i6u B:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 611465Fold d.140: Ribosomal protein S8 [56046] (1 superfamily)
    consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a
  4. 611466Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) (S)
  5. 611467Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein)
  6. 611468Protein Ribosomal protein S8 [56049] (4 species)
  7. 611469Species Archaeon Methanococcus jannaschii [TaxId:2190] [64401] (1 PDB entry)
  8. 611471Domain d1i6ub_: 1i6u B: [61851]
    complexed with so4

Details for d1i6ub_

PDB Entry: 1i6u (more details), 2.6 Å

PDB Description: rna-protein interactions: the crystal structure of ribosomal protein s8/rrna complex from methanococcus jannaschii

SCOP Domain Sequences for d1i6ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i6ub_ d.140.1.1 (B:) Ribosomal protein S8 {Archaeon Methanococcus jannaschii}
mdplanalnhisncervgkkvvyikpaskligrvlkvmqdngyigefefiedgragifkv
eligkinkcgaikprfpvkkfgyekfekrylpardfgilivsttqgvmsheeakkrglgg
rllayvy

SCOP Domain Coordinates for d1i6ub_:

Click to download the PDB-style file with coordinates for d1i6ub_.
(The format of our PDB-style files is described here.)

Timeline for d1i6ub_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1i6ua_