Lineage for d1i6ua_ (1i6u A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1670846Fold d.140: Ribosomal protein S8 [56046] (1 superfamily)
    consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a
  4. 1670847Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) (S)
    automatically mapped to Pfam PF00410
  5. 1670848Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein)
  6. 1670849Protein Ribosomal protein S8 [56049] (4 species)
  7. 1670864Species Methanococcus jannaschii [TaxId:2190] [64401] (1 PDB entry)
  8. 1670865Domain d1i6ua_: 1i6u A: [61850]
    protein/RNA complex; complexed with so4

Details for d1i6ua_

PDB Entry: 1i6u (more details), 2.6 Å

PDB Description: rna-protein interactions: the crystal structure of ribosomal protein s8/rrna complex from methanococcus jannaschii
PDB Compounds: (A:) 30s ribosomal protein s8p

SCOPe Domain Sequences for d1i6ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i6ua_ d.140.1.1 (A:) Ribosomal protein S8 {Methanococcus jannaschii [TaxId: 2190]}
slmdplanalnhisncervgkkvvyikpaskligrvlkvmqdngyigefefiedgragif
kveligkinkcgaikprfpvkkfgyekfekrylpardfgilivsttqgvmsheeakkrgl
ggrllayvy

SCOPe Domain Coordinates for d1i6ua_:

Click to download the PDB-style file with coordinates for d1i6ua_.
(The format of our PDB-style files is described here.)

Timeline for d1i6ua_: