Lineage for d1i6pa_ (1i6p A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 124189Fold c.53: Resolvase-like [53040] (2 superfamilies)
  4. 124226Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (1 family) (S)
  5. 124227Family c.53.2.1: beta-carbonic anhydrase, cab [53057] (1 protein)
  6. 124228Protein beta-carbonic anhydrase [53058] (4 species)
  7. 124236Species Escherichia coli [TaxId:562] [64085] (2 PDB entries)
  8. 124237Domain d1i6pa_: 1i6p A: [61848]

Details for d1i6pa_

PDB Entry: 1i6p (more details), 2 Å

PDB Description: crystal structure of e. coli beta carbonic anhydrase (ecca)

SCOP Domain Sequences for d1i6pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i6pa_ c.53.2.1 (A:) beta-carbonic anhydrase {Escherichia coli}
kdidtlisnnalwskmlveedpgffeklaqaqkprflwigcsdsrvpaerltglepgelf
vhrnvanlvihtdlnclsvvqyavdvlevehiiicghygcggvqaavenpelglinnwll
hirdiwfkhssllgempqerrldtlcelnvmeqvynlghstimqsawkrgqkvtihgway
gihdgllrdldvtatnretleqryrhgisnlklk

SCOP Domain Coordinates for d1i6pa_:

Click to download the PDB-style file with coordinates for d1i6pa_.
(The format of our PDB-style files is described here.)

Timeline for d1i6pa_: