Lineage for d1i6pa_ (1i6p A:)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.53: Resolvase-like [53040] (2 superfamilies) Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (1 family) 
Family c.53.2.1: beta-carbonic anhydrase, cab [53057] (1 protein) Protein beta-carbonic anhydrase [53058] (4 species) Species Escherichia coli [TaxId:562] [64085] (2 PDB entries) 
Domain d1i6pa_: 1i6p A: [61848]
Details for d1i6pa_
PDB Entry: 1i6p (more details), 2 Å
PDB Description: crystal structure of e. coli beta carbonic anhydrase (ecca)
SCOP Domain Sequences for d1i6pa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i6pa_ c.53.2.1 (A:) beta-carbonic anhydrase {Escherichia coli}
kdidtlisnnalwskmlveedpgffeklaqaqkprflwigcsdsrvpaerltglepgelf
vhrnvanlvihtdlnclsvvqyavdvlevehiiicghygcggvqaavenpelglinnwll
hirdiwfkhssllgempqerrldtlcelnvmeqvynlghstimqsawkrgqkvtihgway
gihdgllrdldvtatnretleqryrhgisnlklk
SCOP Domain Coordinates for d1i6pa_:
Click to download the PDB-style file with coordinates for d1i6pa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1i6pa_:
- d1i6pa_ is new in SCOP 1.57
- d1i6pa_ appears in SCOP 1.59
- d1i6pa_ appears in the current release, SCOPe 2.08
View in 3D