Lineage for d1i6ia_ (1i6i A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 69448Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 69449Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families) (S)
  5. 69902Family c.37.1.9: Motor proteins [52641] (3 proteins)
  6. 69903Protein Kinesin [52646] (4 species)
  7. 69909Species Mouse (Mus musculus), kif1a [TaxId:10090] [64017] (2 PDB entries)
  8. 69910Domain d1i6ia_: 1i6i A: [61844]

Details for d1i6ia_

PDB Entry: 1i6i (more details), 2 Å

PDB Description: crystal structure of the kif1a motor domain complexed with mg-amppcp

SCOP Domain Sequences for d1i6ia_:

Sequence, based on SEQRES records: (download)

>d1i6ia_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif1a}
gasvkvavrvrpfnsremsrdskciiqmsgstttivnpkqpketpksfsfdysywshtsp
edinyasqkqvyrdigeemlqhafegynvcifaygqtgagksytmmgkqekdqqgiipql
cedlfsrindttndnmsysvevsymeiycervrdllnpknkgnlrvrehpllgpyvedls
klavtsyndiqdlmdsgnkartvaatnmnetssrshavfniiftqkrhdaetnittekvs
kislvdlagseradstgakgtrlkeganinkslttlgkvisalaemdsgpnknkkkkktd
fipyrdsvltwllrenlggnsrtamvaalspadinydetlstlryadrakqirntvsvnh
hhhh

Sequence, based on observed residues (ATOM records): (download)

>d1i6ia_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif1a}
gasvkvavrvrpfnsremsrdskciiqmsgstttivnpkqpketpksfsfdysywshtsp
edinyasqkqvyrdigeemlqhafegynvcifaygqtgagksytmmgkqekdqqgiipql
cedlfsrindttndnmsysvevsymeiycervrdllnpknkgnlrvrehpllgpyvedls
klavtsyndiqdlmdsgnkartvaatnmnetssrshavfniiftqkrhdaetnittekvs
kislvdlagseaninkslttlgkvisalaemdfipyrdsvltwllrenlggnsrtamvaa
lspadinydetlstlryadrakqirntvhhhhh

SCOP Domain Coordinates for d1i6ia_:

Click to download the PDB-style file with coordinates for d1i6ia_.
(The format of our PDB-style files is described here.)

Timeline for d1i6ia_: