Lineage for d1i6hk_ (1i6h K:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 865191Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 865274Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families) (S)
    form homo and heterodimers
  5. 865355Family d.74.3.2: RBP11/RpoL [64311] (2 proteins)
  6. 865362Protein RPB11 [64312] (1 species)
  7. 865363Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64313] (24 PDB entries)
    Uniprot P38902; part of multichain biological unit
  8. 865371Domain d1i6hk_: 1i6h K: [61842]
    Other proteins in same PDB: d1i6ha_, d1i6hb_, d1i6hc1, d1i6hc2, d1i6he1, d1i6he2, d1i6hf_, d1i6hh_, d1i6hi1, d1i6hi2, d1i6hj_, d1i6hl_
    complexed with mg, zn

Details for d1i6hk_

PDB Entry: 1i6h (more details), 3.3 Å

PDB Description: rna polymerase ii elongation complex
PDB Compounds: (K:) DNA-directed RNA polymerase II 13.6kd polypeptide

SCOP Domain Sequences for d1i6hk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i6hk_ d.74.3.2 (K:) RPB11 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mnapdrfelfllgegesklkidpdtkapnavvitfekedhtlgnliraellndrkvlfaa
ykvehpffarfklriqttegydpkdalknacnsiinklgalktnfetewnlqtl

SCOP Domain Coordinates for d1i6hk_:

Click to download the PDB-style file with coordinates for d1i6hk_.
(The format of our PDB-style files is described here.)

Timeline for d1i6hk_: