Lineage for d1i6hj_ (1i6h J:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 634286Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 636147Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family) (S)
  5. 636148Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (1 protein)
    Zn-binding site is near the N-terminus
  6. 636149Protein RNA polymerase subunit RPB10 [46926] (2 species)
  7. 636152Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63490] (24 PDB entries)
  8. 636161Domain d1i6hj_: 1i6h J: [61841]
    Other proteins in same PDB: d1i6ha_, d1i6hb_, d1i6hc1, d1i6hc2, d1i6he1, d1i6he2, d1i6hf_, d1i6hh_, d1i6hi1, d1i6hi2, d1i6hk_, d1i6hl_
    complexed with mg, zn

Details for d1i6hj_

PDB Entry: 1i6h (more details), 3.3 Å

PDB Description: rna polymerase ii elongation complex
PDB Compounds: (J:) DNA-directed RNA polymerase II 8.3kd polypeptide

SCOP Domain Sequences for d1i6hj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i6hj_ a.4.11.1 (J:) RNA polymerase subunit RPB10 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
lrynp

SCOP Domain Coordinates for d1i6hj_:

Click to download the PDB-style file with coordinates for d1i6hj_.
(The format of our PDB-style files is described here.)

Timeline for d1i6hj_: