SCOP 1.65: Domain d1i6hi2: 1i6h I:50-120

Lineage for d1i6hi2 (1i6h I:50-120)

1. Root: SCOP 1.65

2. Class g: Small proteins [56992] (66 folds)

3. Fold g.41: Rubredoxin-like [57769] (12 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.3: Zinc beta-ribbon [57783] (3 families)

5. Family g.41.3.1: Transcriptional factor domain [57784] (3 proteins)

6. Protein RBP9 subunit of RNA polymerase II [57787] (2 species)
   contains two differently decorated domains of this fold

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64575] (4 PDB entries)

8. Domain d1i6hi2: 1i6h I:50-120 [61840]
   Other proteins in same PDB: d1i6ha_, d1i6hb_, d1i6hc1, d1i6hc2, d1i6he1, d1i6he2, d1i6hf_, d1i6hh_, d1i6hj_, d1i6hk_, d1i6hl_
   complexed with mg, zn

Details for d1i6hi2

PDB Entry: 1i6h, 3.3 Å

PDB Description: rna polymerase ii elongation complex

SCOP Domain Sequences for d1i6hi2:

Sequence; same for both SEQRES and ATOM records:

>d1i6hi2 g.41.3.1 (I:50-120) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae)}
tnigetagvvqdigsdptlprsdrecpkchsrenvffqsqqrrkdtsmvlffvclscshi
ftsdqknkrtq

Timeline for d1i6hi2:

• d1i6hi2 first appeared in SCOP 1.57
  
• d1i6hi2 appears in SCOP 1.63
  
• d1i6hi2 appears in SCOP 1.67
  
• d1i6hi2 appears in the current release, SCOPe 2.08