Lineage for d1i6hi1 (1i6h I:2-49)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 144883Fold g.41: Rubredoxin-like [57769] (9 superfamilies)
  4. 145106Superfamily g.41.9: Zn-binding RNA polymerase subunits [63393] (2 families) (S)
  5. 145107Family g.41.9.1: RBP9 subunit of RNA polymerase II [63394] (1 protein)
  6. 145108Protein RBP9 subunit of RNA polymerase II [57787] (2 species)
  7. 145111Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64575] (4 PDB entries)
  8. 145118Domain d1i6hi1: 1i6h I:2-49 [61839]
    Other proteins in same PDB: d1i6ha_, d1i6hb_, d1i6hc1, d1i6hc2, d1i6he1, d1i6he2, d1i6hf_, d1i6hh_, d1i6hj_, d1i6hk_, d1i6hl_

Details for d1i6hi1

PDB Entry: 1i6h (more details), 3.3 Å

PDB Description: rna polymerase ii elongation complex
PDB Compounds: (I:)

SCOP Domain Sequences for d1i6hi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i6hi1 g.41.9.1 (I:2-49) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae)}
ttfrfcrdcnnmlypredkennrllfecrtcsyveeagsplvyrheli

SCOP Domain Coordinates for d1i6hi1:

Click to download the PDB-style file with coordinates for d1i6hi1.
(The format of our PDB-style files is described here.)

Timeline for d1i6hi1: