SCOP 1.57: Domain d1i6hi1: 1i6h I:2-49

Lineage for d1i6hi1 (1i6h I:2-49)

1. Root: SCOP 1.57

2. Class g: Small proteins [56992] (56 folds)

3. Fold g.41: Rubredoxin-like [57769] (9 superfamilies)

4. Superfamily g.41.9: Zn-binding RNA polymerase subunits [63393] (2 families)

5. Family g.41.9.1: RBP9 subunit of RNA polymerase II [63394] (1 protein)

6. Protein RBP9 subunit of RNA polymerase II [57787] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64575] (3 PDB entries)

8. Domain d1i6hi1: 1i6h I:2-49 [61839]
   Other proteins in same PDB: d1i6ha_, d1i6hb_, d1i6hc1, d1i6hc2, d1i6he1, d1i6he2, d1i6hf_, d1i6hh_, d1i6hj_, d1i6hk_, d1i6hl_

Details for d1i6hi1

PDB Entry: 1i6h, 3.3 Å

PDB Description: rna polymerase ii elongation complex

SCOP Domain Sequences for d1i6hi1:

Sequence; same for both SEQRES and ATOM records:

>d1i6hi1 g.41.9.1 (I:2-49) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae)}
ttfrfcrdcnnmlypredkennrllfecrtcsyveeagsplvyrheli

Timeline for d1i6hi1:

• d1i6hi1 is new in SCOP 1.57
  
• d1i6hi1 appears in SCOP 1.59
  
• d1i6hi1 appears in the current release, SCOPe 2.08