| Class g: Small proteins [56992] (56 folds) |
| Fold g.41: Rubredoxin-like [57769] (9 superfamilies) |
Superfamily g.41.9: Zn-binding RNA polymerase subunits [63393] (2 families) ![]() |
| Family g.41.9.1: RBP9 subunit of RNA polymerase II [63394] (1 protein) |
| Protein RBP9 subunit of RNA polymerase II [57787] (2 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64575] (3 PDB entries) |
| Domain d1i6hi1: 1i6h I:2-49 [61839] Other proteins in same PDB: d1i6ha_, d1i6hb_, d1i6hc1, d1i6hc2, d1i6he1, d1i6he2, d1i6hf_, d1i6hh_, d1i6hj_, d1i6hk_, d1i6hl_ |
PDB Entry: 1i6h (more details), 3.3 Å
SCOP Domain Sequences for d1i6hi1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i6hi1 g.41.9.1 (I:2-49) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae)}
ttfrfcrdcnnmlypredkennrllfecrtcsyveeagsplvyrheli
Timeline for d1i6hi1: