Lineage for d1i6hh_ (1i6h H:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 296800Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 297373Superfamily b.40.4: Nucleic acid-binding proteins [50249] (11 families) (S)
  5. 297805Family b.40.4.8: RNA polymerase subunit RBP8 [50321] (1 protein)
    duplication; contains tandem repeat of two incomplete OB-folds; forms a singlebarrel; n=8, S=10
  6. 297806Protein RNA polymerase subunit RBP8 [50322] (1 species)
  7. 297807Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50323] (5 PDB entries)
  8. 297811Domain d1i6hh_: 1i6h H: [61838]
    Other proteins in same PDB: d1i6ha_, d1i6hb_, d1i6hc1, d1i6hc2, d1i6he1, d1i6he2, d1i6hf_, d1i6hi1, d1i6hi2, d1i6hj_, d1i6hk_, d1i6hl_
    complexed with mg, zn

Details for d1i6hh_

PDB Entry: 1i6h (more details), 3.3 Å

PDB Description: rna polymerase ii elongation complex

SCOP Domain Sequences for d1i6hh_:

Sequence, based on SEQRES records: (download)

>d1i6hh_ b.40.4.8 (H:) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae)}
sntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtias
slnledtpandssatrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggl
lmrlegnyrnlnnlkqenayllirr

Sequence, based on observed residues (ATOM records): (download)

>d1i6hh_ b.40.4.8 (H:) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae)}
sntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtias
sltrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggllmrlegnyrnln
nlkqenayllirr

SCOP Domain Coordinates for d1i6hh_:

Click to download the PDB-style file with coordinates for d1i6hh_.
(The format of our PDB-style files is described here.)

Timeline for d1i6hh_: