Lineage for d1i6hh_ (1i6h H:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 110053Fold b.40: OB-fold [50198] (8 superfamilies)
  4. 110553Superfamily b.40.4: Nucleic acid-binding proteins [50249] (9 families) (S)
  5. 110844Family b.40.4.8: RNA polymerase subunit RBP8 [50321] (1 protein)
  6. 110845Protein RNA polymerase subunit RBP8 [50322] (1 species)
  7. 110846Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50323] (5 PDB entries)
  8. 110850Domain d1i6hh_: 1i6h H: [61838]
    Other proteins in same PDB: d1i6ha_, d1i6hb_, d1i6hc1, d1i6hc2, d1i6he1, d1i6he2, d1i6hf_, d1i6hi1, d1i6hi2, d1i6hj_, d1i6hk_, d1i6hl_

Details for d1i6hh_

PDB Entry: 1i6h (more details), 3.3 Å

PDB Description: rna polymerase ii elongation complex
PDB Compounds: (H:)

SCOP Domain Sequences for d1i6hh_:

Sequence, based on SEQRES records: (download)

>d1i6hh_ b.40.4.8 (H:) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae)}
sntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtias
slnledtpandssatrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggl
lmrlegnyrnlnnlkqenayllirr

Sequence, based on observed residues (ATOM records): (download)

>d1i6hh_ b.40.4.8 (H:) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae)}
sntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtias
sltrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggllmrlegnyrnln
nlkqenayllirr

SCOP Domain Coordinates for d1i6hh_:

Click to download the PDB-style file with coordinates for d1i6hh_.
(The format of our PDB-style files is described here.)

Timeline for d1i6hh_: