Class a: All alpha proteins [46456] (289 folds) |
Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily) core: 2 helices and adjacent loops |
Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits |
Family a.143.1.2: RPB6 [55294] (2 proteins) |
Protein RPB6 [55295] (3 species) essential subunit of RNA polymerases I, II and III |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64318] (30 PDB entries) Uniprot P20435; part of multichain biological unit |
Domain d1i6hf_: 1i6h F: [61837] Other proteins in same PDB: d1i6ha_, d1i6hb_, d1i6hc1, d1i6hc2, d1i6he1, d1i6he2, d1i6hh_, d1i6hi1, d1i6hi2, d1i6hj_, d1i6hk_, d1i6hl_ protein/DNA complex; protein/RNA complex; complexed with mg, zn |
PDB Entry: 1i6h (more details), 3.3 Å
SCOPe Domain Sequences for d1i6hf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i6hf_ a.143.1.2 (F:) RPB6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} kaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekkip lvirrylpdgsfedwsveelivdl
Timeline for d1i6hf_: