Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
Fold d.78: RPB5-like RNA polymerase subunit [55286] (1 superfamily) core: beta-alpha-beta-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.78.1: RPB5-like RNA polymerase subunit [55287] (2 families) |
Family d.78.1.2: RPB6 [55294] (1 protein) |
Protein RPB6 [55295] (2 species) essential subunit of RNA polymerases I, II and III |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64318] (4 PDB entries) |
Domain d1i6hf_: 1i6h F: [61837] Other proteins in same PDB: d1i6ha_, d1i6hb_, d1i6hc1, d1i6hc2, d1i6he1, d1i6he2, d1i6hh_, d1i6hi1, d1i6hi2, d1i6hj_, d1i6hk_, d1i6hl_ complexed with mg, zn |
PDB Entry: 1i6h (more details), 3.3 Å
SCOP Domain Sequences for d1i6hf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i6hf_ d.78.1.2 (F:) RPB6 {Baker's yeast (Saccharomyces cerevisiae)} kaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekkip lvirrylpdgsfedwsveelivdl
Timeline for d1i6hf_: