Lineage for d1i6he2 (1i6h E:144-215)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565294Fold d.78: RPB5-like RNA polymerase subunit [55286] (1 superfamily)
    core: beta-alpha-beta-alpha-beta(2); 2 layers, alpha/beta
  4. 2565295Superfamily d.78.1: RPB5-like RNA polymerase subunit [55287] (2 families) (S)
    automatically mapped to Pfam PF01191
  5. 2565296Family d.78.1.1: RPB5 [55288] (2 proteins)
  6. 2565297Protein Eukaryotic RPB5 C-terminal domain [55292] (2 species)
  7. 2565298Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55293] (27 PDB entries)
    Uniprot P20434; part of multichain biological unit
  8. 2565309Domain d1i6he2: 1i6h E:144-215 [61836]
    Other proteins in same PDB: d1i6ha_, d1i6hb_, d1i6hc1, d1i6hc2, d1i6he1, d1i6hf_, d1i6hh_, d1i6hi1, d1i6hi2, d1i6hj_, d1i6hk_, d1i6hl_
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d1i6he2

PDB Entry: 1i6h (more details), 3.3 Å

PDB Description: rna polymerase ii elongation complex
PDB Compounds: (E:) DNA-directed RNA polymerase II 27kd polypeptide

SCOPe Domain Sequences for d1i6he2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i6he2 d.78.1.1 (E:144-215) Eukaryotic RPB5 C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ithhelvpkhirlssdekrellkryrlkesqlpriqradpvalylglkrgevvkiirkse
tsgryasyricm

SCOPe Domain Coordinates for d1i6he2:

Click to download the PDB-style file with coordinates for d1i6he2.
(The format of our PDB-style files is described here.)

Timeline for d1i6he2: