SCOP 1.65: Domain d1i6he2: 1i6h E:144-215

Lineage for d1i6he2 (1i6h E:144-215)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.78: RPB5-like RNA polymerase subunit [55286] (1 superfamily)
   core: beta-alpha-beta-alpha-beta(2); 2 layers, alpha/beta

4. Superfamily d.78.1: RPB5-like RNA polymerase subunit [55287] (2 families)

5. Family d.78.1.1: RPB5 [55288] (2 proteins)

6. Protein Eukaryotic RPB5 C-terminal domain [55292] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55293] (5 PDB entries)

8. Domain d1i6he2: 1i6h E:144-215 [61836]
   Other proteins in same PDB: d1i6ha_, d1i6hb_, d1i6hc1, d1i6hc2, d1i6he1, d1i6hf_, d1i6hh_, d1i6hi1, d1i6hi2, d1i6hj_, d1i6hk_, d1i6hl_
   complexed with mg, zn

Details for d1i6he2

PDB Entry: 1i6h, 3.3 Å

PDB Description: rna polymerase ii elongation complex

SCOP Domain Sequences for d1i6he2:

Sequence; same for both SEQRES and ATOM records:

>d1i6he2 d.78.1.1 (E:144-215) Eukaryotic RPB5 C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
ithhelvpkhirlssdekrellkryrlkesqlpriqradpvalylglkrgevvkiirkse
tsgryasyricm

Timeline for d1i6he2:

• d1i6he2 first appeared in SCOP 1.57
  
• d1i6he2 appears in SCOP 1.63
  
• d1i6he2 appears in SCOP 1.67
  
• d1i6he2 appears in the current release, SCOPe 2.08