SCOP 1.65: Domain d1i6he1: 1i6h E:2-143

Lineage for d1i6he1 (1i6h E:2-143)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.3: Eukaryotic RPB5 N-terminal domain [53036] (1 family)

5. Family c.52.3.1: Eukaryotic RPB5 N-terminal domain [53037] (1 protein)

6. Protein Eukaryotic RPB5 N-terminal domain [53038] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53039] (5 PDB entries)

8. Domain d1i6he1: 1i6h E:2-143 [61835]
   Other proteins in same PDB: d1i6ha_, d1i6hb_, d1i6hc1, d1i6hc2, d1i6he2, d1i6hf_, d1i6hh_, d1i6hi1, d1i6hi2, d1i6hj_, d1i6hk_, d1i6hl_
   complexed with mg, zn

Details for d1i6he1

PDB Entry: 1i6h, 3.3 Å

PDB Description: rna polymerase ii elongation complex

SCOP Domain Sequences for d1i6he1:

Sequence; same for both SEQRES and ATOM records:

>d1i6he1 c.52.3.1 (E:2-143) Eukaryotic RPB5 N-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
dqenernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsfq
anpteesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsam
klvpsippatietfneaalvvn

Timeline for d1i6he1:

• d1i6he1 first appeared in SCOP 1.57
  
• d1i6he1 appears in SCOP 1.63
  
• d1i6he1 appears in SCOP 1.67
  
• d1i6he1 appears in the current release, SCOPe 2.08