Lineage for d1i6hb_ (1i6h B:)

  1. Root: SCOP 1.59
  2. 140364Class e: Multi-domain proteins (alpha and beta) [56572] (34 folds)
  3. 141611Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
  4. 141612Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
  5. 141623Family e.29.1.2: RNA-polymerase beta-prime [64490] (2 proteins)
  6. 141624Protein RBP2 [64491] (1 species)
  7. 141625Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64492] (4 PDB entries)
  8. 141629Domain d1i6hb_: 1i6h B: [61832]
    Other proteins in same PDB: d1i6ha_, d1i6hc1, d1i6hc2, d1i6he1, d1i6he2, d1i6hf_, d1i6hh_, d1i6hi1, d1i6hi2, d1i6hj_, d1i6hk_, d1i6hl_

Details for d1i6hb_

PDB Entry: 1i6h (more details), 3.3 Å

PDB Description: rna polymerase ii elongation complex
PDB Compounds: (B:)

SCOP Domain Sequences for d1i6hb_:

Sequence, based on SEQRES records: (download)

>d1i6hb_ e.29.1.2 (B:) RBP2 {Baker's yeast (Saccharomyces cerevisiae)}
desapitaedswavisaffrekglvsqqldsfnqfvdytlqdiicedstlileqlaqhtt
esdnisrkyeisfgkiyvtkpmvnesdgvthalypqearlrnltyssglfvdvkkrtyea
idvpgrelkyeliaeeseddsesgkvfigrlpimlrskncylseatesdlyklkecpfdm
ggyfiingsekvliaqersagnivqvfkkaapspishvaeirsalekgsrfistlqvkly
gregssartikatlpyikqdipiviifralgiipdgeilehicydvndwqmlemlkpcve
dgfviqdretaldfigrrgtalgikkekriqyakdilqkeflphitqlegfesrkafflg
yminrlllcaldrkdqddrdhfgkkrldlagpllaqlfktlfkkltkdifrymqrtveea
hdfnmklainaktitsglkyalatgnwgeqkkamssragvsqvlnrytysstlshlrrtn
tpigrdgklakprqlhnthwglvcpaetpegqacglvknlslmscisvgtdpmpiitfls
ewgmepledyvphqspdatrvfvngvwhgvhrnparlmetlrtlrrkgdinpevsmirdi
rekelkiftdagrvyrplfiveddeslghkelkvrkghiaklmateyqdieggfedveey
twssllneglveyidaeeeesiliamqpedlepaeaneendldvdpakrirvshhattft
hceihpsmilgvaasiipfpdhnqsprntyqsamgkqamgvfltnynvrmdtmanilyyp
qkplgttrameylkfrelpagqnaivaiacysgynqedsmimnqssidrglfrslffrsy
mdqekkygmsitetfekpqrtntlrmkhgtydkldddgliapgvrvsgedviigkttpis
pdeeelgqrtayhskrdastplrstengivdqvlvttnqdglkfvkvrvrttkipqigdk
fasrhgqkgtigityrredmpftaegivpdliinphaipsrmtvahliecllskvaalsg
negdaspftditvegiskllrehgyqsrgfevmynghtgkklmaqiffgptyyqrlrhmv
ddkiharargpmqvltrqpvegrsrdgglrfgemerdcmiahgaasflkerlmeasdafr
vhicgicglmtviaklnhnqfeckgcdnkidiyqihipyaakllfqelmamnitprlytd
rsrdf

Sequence, based on observed residues (ATOM records): (download)

>d1i6hb_ e.29.1.2 (B:) RBP2 {Baker's yeast (Saccharomyces cerevisiae)}
desapitaedswavisaffrekglvsqqldsfnqfvdytlqdiicedstliisfgkiyvt
kpmvnesdgvthalypqearlrnltyssglfvdvkkkvfigrlpimlrskncylseates
dlyklkecpfdmggyfiingsekvliaqersagnivqvfkkaapspishvaeirsalekg
srfistlqvklygregssartikatlpyikqdipiviifralgiipdgeilehicydvnd
wqmlemlkpcvedgfviqdretaldfigkekriqyakdilqkeflphitqlegfesrkaf
flgyminrlllcaldrkdqddrdhfgkkrldlagpllaqlfktlfkkltkdifrymqrtv
elainaktitsglkyalatgnwgagvsqvlnrytysstlshlrrtntpiakprqlhnthw
glvcpaetpegqacglvknlslmscisvgtdpmpiitflsewgmepledyvphqspdatr
vfvngvwhgvhrnparlmetlrtlrrkgdinpevsmirdirekelkiftdagrvyrplfi
veddeslghkelkvrkghiaklmateyqdeytwssllneglveyidaeeeesiliamqpe
dlepaeadvdpakrirvshhattfthceihpsmilgvaasiipfpdhnqsprntyqsamg
kqamgvfltnynvrmdtmanilyypqkplgttrameylkfrelpagqnaivaiacysgyn
qedsmimnqssidrglfrslffrsymdqekkygmsitetfekpqrtntlrmkhgtydkld
ddgliapgvrvsgedviigkttpisskrdastplrstengivdqvlvttnqdglkfvkvr
vrttkipqigdkfasrhgqkgtigityrredmpftaegivpdliinphaipsrmtvahli
ecllskvaalsgnegdaspftditvegiskllrehgyqsrgfevmynghtgkklmaqiff
gptyyqrlrhmvddkiharargpmqvltrqpvegrsrdgglrfgemerdcmiahgaasfl
kerlmeasdafrvhicgicglmtviaklnhnqfeckgcdnkidiyqihipyaakllfqel
mamnitprlytdrsrdf

SCOP Domain Coordinates for d1i6hb_:

Click to download the PDB-style file with coordinates for d1i6hb_.
(The format of our PDB-style files is described here.)

Timeline for d1i6hb_: