Lineage for d1i6ha_ (1i6h A:)

  1. Root: SCOPe 2.01
  2. 1054197Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1057387Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
    Multidomain subunits of complex domain organization
  4. 1057388Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
    The catalytic site is formed by the association of two double-psi beta-barrel domains, one from each subunit
  5. 1057461Family e.29.1.2: RNA-polymerase beta-prime [64490] (2 proteins)
  6. 1057462Protein RBP1 [64486] (1 species)
  7. 1057463Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64487] (24 PDB entries)
    Uniprot P04050; part of multichain biological unit
  8. 1057472Domain d1i6ha_: 1i6h A: [61831]
    Other proteins in same PDB: d1i6hb_, d1i6hc1, d1i6hc2, d1i6he1, d1i6he2, d1i6hf_, d1i6hh_, d1i6hi1, d1i6hi2, d1i6hj_, d1i6hk_, d1i6hl_
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d1i6ha_

PDB Entry: 1i6h (more details), 3.3 Å

PDB Description: rna polymerase ii elongation complex
PDB Compounds: (A:) DNA-directed RNA polymerase II largest subunit

SCOPe Domain Sequences for d1i6ha_:

Sequence, based on SEQRES records: (download)

>d1i6ha_ e.29.1.2 (A:) RBP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vgqqyssaplrtvkevqfglfspeevraisvakirfpetmdetqtrakigglndprlgsi
drnlkcqtcqegmnecpghfghidlakpvfhvgfiakikkvcecvcmhcgkllldehnel
mrqalaikdskkrfaaiwtlcktkmvcetdvpseddptqlvsrggcgntqptirkdglkl
vgswkkdratgdadepelrvlsteeilnifkhisvkdftslgfnevfsrpewmiltclpv
ppppvrpsisfnesqrgeddltfkladilkanisletlehngaphhaieeaesllqfhva
tymdndiagqpqalqksgrpvksirarlkgkegrirgnlmgkrvdfsartvisgdpnlel
dqvgvpksiaktltypevvtpynidrltqlvrngpnehpgakyvirdsgdridlryskra
gdiqlqygwkverhimdndpvlfnrqpslhkmsmmahrvkvipystfrlnlsvtspynad
fdgdemnlhvpqseetraelsqlcavplqivspqsnkpcmgivqdtlcgirkltlrdtfi
eldqvlnmlywvpdwdgviptpaiikpkplwsgkqilsvaipngihlqrfdegttllspk
dngmliidgqiifgvvekktvgssngglihvvtrekgpqvcaklfgniqkvvnfwllhng
fstgigdtiadgptmreitetiaeakkkvldvtkeaqanlltakhgmtlresfednvvrf
lneardkagrlaevnlkdlnnvkqmvmagskgsfiniaqmsacvgqqsvegkriafgfvd
rtlphfskddyspeskgfvensylrgltpqefffhamggreglidtavktaetgyiqrrl
vkaledimvhydnttrnslgnviqfiygedgmdaahiekqsldtiggsdaafekryrvdl
lntdhtldpsllesgseilgdlklqvlldeeykqlvkdrkflrevfvdgeanwplpvnir
riiqnaqqtfhidhtkpsdltikdivlgvkdlqenllvlrgkneiiqnaqrdavtlfccl
lrsrlatrrvlqeyrltkqafdwvlsnieaqflrsvvhpgemvgvlaaqsigepatqmtl
ntfhfagvaskkvtsgvprlkeilnvaknmktpsltvylepghaadqeqaklirsaieht
tlksvtiaseiyydpdprstvipedeeiiqlhfslldeeaeqsfdqqspwllrleldraa
mndkdltmgqvgerikqtfkndlfviwsedndekliircrvvrpksldaeteaeedhmlk
kientmlenitlrgveniervvmmkydrkvpsptgeyvkepewvletdgvnlsevmtvpg
idptriytnsfidimevlgieagraalykevynviasdgsyvnyrhmallvdvmttqggl
tsvtrhgfnrsntgalmrcsfeetveilfeagasaelddcrgvsenvilgqmapigtgaf
dvmi

Sequence, based on observed residues (ATOM records): (download)

>d1i6ha_ e.29.1.2 (A:) RBP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vgqqyssaplrtvkevqfglfspeevraisvakirfpetmdetqtrakigglndprlgsi
drnlkcqtcqegmnecpghfghidlakpvfhvgfiakikkvcecvcmhcgkllldehnel
mrqalaikdskkrfaaiwtlcktkmvcetdvpslvsrggcgntqptirkdglklvgswkl
rvlsteeilnifkhisvkdftslgfnevfsrpewmiltclpvppppvrpseddltfklad
ilkanisletlehngaphhaieeaesllqfhvatymdndiagqpqapvksirarlkgkeg
rirgnlmgkrvdfsartvisgdpnleldqvgvpksiaktltypevvtpynidrltqlvrn
gpnehpgakyvirdsgdridlryskragdiqlqygwkverhimdndpvlfnrqpslhkms
mmahrvkvipystfrlnlsvtspynadfdgdemnlhvpqseetraelsqlcavplqivsp
qsnkpcmgivqdtlcgirkltlrdtfieldqvlnmlywvpdwdgviptpaiikpkplwsg
kqilsvaipngihlqrfdegttllspkdngmliidgqiifgvvekktvgssngglihvvt
rekgpqvcaklfgniqkvvnfwllhngfstgigdtiadgptmreitetiaeakkkvldvt
keaqanlltakhgmtlresfednvvrflneardkagrlaevnlkdlnnvkqmvmagskgs
finiaqmsacvgqqsvegkriafgfvdrtlphfskddyspeskgfvensylrgltpqeff
fhamggreglidtavktaetgyiqrrlvkaledimvhydnttrnslgnviqfiygedgmd
aahiekqsldtiggsdaafekryrvdllntdhtldpsllesgseilgdlklqvlldeeyk
qlvkdrkflrevfvdgeanwplpvnirriiqnaqqtfhidhtkpsdltikdivlgvkdlq
enllvlrgkneiiqnaqrdavtlfccllrsrlatrrvlqeyrltkqafdwvlsnieaqfl
rsvvhpgemvgvlaaqsigepatqmtlkkvtsgvprlkeilnvaknmktpsltvylepgh
aadqeqaklirsaiehttlksvtiaseiyydpdprstvipedeeiiqlhfslqqspwllr
leldraamndkdltmgqvgerikqtfkndlfviwsedndekliircrvvaeedhmlkkie
ntmlenitlrgveniervvmmkydrkvpsptgeyvkepewvletdgvnlsevmtvpgidp
triytnsfidimevlgieagraalykevynviasdgsyvnyrhmallvdvmttqggltsv
trhgfnrsntgalmrcsfeetveilfeagasaelddcrgvsenvilgqmapigtgafdvm
i

SCOPe Domain Coordinates for d1i6ha_:

Click to download the PDB-style file with coordinates for d1i6ha_.
(The format of our PDB-style files is described here.)

Timeline for d1i6ha_: